Thông tin công ty
  • Taizhou Volsen Chemical Co., Ltd.

  •  [Zhejiang,China]
  • Loại hình kinh doanh:nhà chế tạo
  • Main Mark: Châu Mỹ , Châu Á , Đông Âu , Châu Âu , Bắc Âu , Các thị trường khác , Tây Âu , Trên toàn thế giới
  • xuất khẩu:91% - 100%
  • certs:GS, CE, ISO9001, ISO14000
  • Sự miêu tả:7-37-Glucagon giống như Peptid Human 106612-94-6,Độ tinh khiết cao Người GLP-1 7-37 CAS 106612-94-6,Nguyên liệu thô GLP-1 Acetate
Taizhou Volsen Chemical Co., Ltd. 7-37-Glucagon giống như Peptid Human 106612-94-6,Độ tinh khiết cao Người GLP-1 7-37 CAS 106612-94-6,Nguyên liệu thô GLP-1 Acetate
Nhà > Sản phẩm > Sản phẩm peptide > Độ tinh khiết cao 98% Peptide Hormon Tăng trưởng của Con người GLP-1 CAS 106612-94-6

Độ tinh khiết cao 98% Peptide Hormon Tăng trưởng của Con người GLP-1 CAS 106612-94-6

Chia sẻ với:  
    Đơn giá: USD 1 / Kilogram
    Hình thức thanh toán: T/T
    Incoterm: CIF
    Đặt hàng tối thiểu: 1 Kilogram
    Thời gian giao hàng: 15 Ngày

Thông tin cơ bản

Mẫu số: 106612-94-6

Additional Info

Bao bì: THEO YÊU CẦU

Năng suất: KGS

Thương hiệu: VOLSENCHEM

Giao thông vận tải: Air

Xuất xứ: TRUNG QUỐC

Cung cấp khả năng: TRUE MANUFACTURER

Giấy chứng nhận: GMP Peptide

Mô tả sản phẩm

Chúng tôi cung cấp chất lượng và độ tinh khiết cao GLP-1 CAS 106612-94-6. Glucagon giống như peptide -1 (GLP-1) là một loại tế bào nội tiết đường ruột trong ruột của bộ não, hiện nay chủ yếu là mục tiêu cho hoạt động của thuốc tiểu đường tuýp 2. Lợi thế của GLP-1 CAS 106612-94-6 có thể làm giảm sự ức chế rỗng dạ dày, ruột non. Điều này cung cấp một triển vọng rất tốt cho việc điều trị bệnh đái tháo đường týp 2. Nhưng vì GLP-1 là một polypeptide, không thể dùng bằng miệng là một thiếu sót chủ yếu. Chúng tôi khéo léo để sản xuất GLP-1 độ tinh khiết cao. Chúng tôi có thể cung cấp bao bì khác nhau để đáp ứng yêu cầu của khách hàng.


Thera. Cát egory: Dược Peptide

Cas Số:. 106612-94-6

Từ đồng nghĩa: PROGLUCAGON (78-108) (NHÂN, trâu, bò, GUINEA PIG, MOUSE, RAT); PREPROGLUCAGON 78-108 NHÂN; PREPROGLUCAGON (98-128) (NHÂN, trâu, bò, GUINEA PIG, MOUSE, RAT); INSULINOTROPIN (NHÂN, trâu, bò, GUINEA PIG, MOUSE, RAT); HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP- LEU-VAL-LYS-Gly-ARG-Gly; H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA- TRP-LEU-VAL-LYS-Gly-ARG-Gly-OH; HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG; GLP-1 (NGƯỜI NHÂN, 7-37) (BOVINE, CANINE, RAT, GUINEA PIG)

106612-94-6

Công thức phân tử: C151H228N40O47

Trọng lượng phân tử: 3355,67

Thanh Tịnh: ≥98%

Đóng gói: xuất khẩu bao bì xứng đáng

Bảng Dữ liệu An toàn Vật liệu: Có sẵn theo yêu cầu

Sử dụng: được sử dụng như một hoocmon paracrine liên quan đến sự ức chế glucagon

Danh mục sản phẩm : Sản phẩm peptide

Hình ảnh sản phẩm
  • Độ tinh khiết cao 98% Peptide Hormon Tăng trưởng của Con người GLP-1 CAS 106612-94-6
Gửi email cho nhà cung cấp này
  • *Chủ đề:
  • *Tin nhắn:
    Tin nhắn của bạn phải trong khoảng từ 20-8000 nhân vật

Trang web di động Chỉ số. Sơ đồ trang web


Đăng ký vào bản tin của chúng tôi:
Nhận được Cập Nhật, giảm giá, đặc biệt
Cung cấp và giải thưởng lớn!

MultiLanguage:
Bản quyền © 2019 Taizhou Volsen Chemical Co., Ltd. tất cả các quyền.
Giao tiếp với nhà cung cấp?Nhà cung cấp
Amy Cheng Ms. Amy Cheng
Tôi có thể giúp gì cho bạn?
Trò chuyện bây giờ Liên hệ với nhà cung cấp