Taizhou Volsen Chemical Co., Ltd.
Trang ChủSản phẩmSản phẩm peptideĐộ tinh khiết cao 98% Peptide Hormon Tăng trưởng của Con người GLP-1 CAS 106612-94-6
Độ tinh khiết cao 98% Peptide Hormon Tăng trưởng của Con người GLP-1 CAS 106612-94-6
  • Độ tinh khiết cao 98% Peptide Hormon Tăng trưởng của Con người GLP-1 CAS 106612-94-6

Độ tinh khiết cao 98% Peptide Hormon Tăng trưởng của Con người GLP-1 CAS 106612-94-6

    Đơn giá: USD 1 / Kilogram
    Hình thức thanh toán: T/T
    Incoterm: CIF
    Đặt hàng tối thiểu: 1 Kilogram
    Thời gian giao hàng: 15 Ngày

Thông tin cơ bản

Mẫu số: 106612-94-6

Additional Info

Bao bì: THEO YÊU CẦU

Năng suất: KGS

Thương hiệu: VOLSENCHEM

Giao thông vận tải: Air

Xuất xứ: TRUNG QUỐC

Cung cấp khả năng: TRUE MANUFACTURER

Giấy chứng nhận: GMP Peptide

Mô tả sản phẩm

Chúng tôi cung cấp chất lượng và độ tinh khiết cao GLP-1 CAS 106612-94-6. Glucagon giống như peptide -1 (GLP-1) là một loại tế bào nội tiết đường ruột trong ruột của bộ não, hiện nay chủ yếu là mục tiêu cho hoạt động của thuốc tiểu đường tuýp 2. Lợi thế của GLP-1 CAS 106612-94-6 có thể làm giảm sự ức chế rỗng dạ dày, ruột non. Điều này cung cấp một triển vọng rất tốt cho việc điều trị bệnh đái tháo đường týp 2. Nhưng vì GLP-1 là một polypeptide, không thể dùng bằng miệng là một thiếu sót chủ yếu. Chúng tôi khéo léo để sản xuất GLP-1 độ tinh khiết cao. Chúng tôi có thể cung cấp bao bì khác nhau để đáp ứng yêu cầu của khách hàng.


Thera. Cát egory: Dược Peptide

Cas Số:. 106612-94-6

Từ đồng nghĩa: PROGLUCAGON (78-108) (NHÂN, trâu, bò, GUINEA PIG, MOUSE, RAT); PREPROGLUCAGON 78-108 NHÂN; PREPROGLUCAGON (98-128) (NHÂN, trâu, bò, GUINEA PIG, MOUSE, RAT); INSULINOTROPIN (NHÂN, trâu, bò, GUINEA PIG, MOUSE, RAT); HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP- LEU-VAL-LYS-Gly-ARG-Gly; H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA- TRP-LEU-VAL-LYS-Gly-ARG-Gly-OH; HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG; GLP-1 (NGƯỜI NHÂN, 7-37) (BOVINE, CANINE, RAT, GUINEA PIG)

106612-94-6

Công thức phân tử: C151H228N40O47

Trọng lượng phân tử: 3355,67

Thanh Tịnh: ≥98%

Đóng gói: xuất khẩu bao bì xứng đáng

Bảng Dữ liệu An toàn Vật liệu: Có sẵn theo yêu cầu

Sử dụng: được sử dụng như một hoocmon paracrine liên quan đến sự ức chế glucagon

Danh mục sản phẩm : Sản phẩm peptide

Gửi email cho nhà cung cấp này
  • Amy ChengMs. Amy Cheng
  • Tin nhắn của bạn phải trong khoảng từ 20-8000 nhân vật

Danh sách sản phẩm liên quan