Thông tin công ty
  • Taizhou Volsen Chemical Co., Ltd.

  •  [Zhejiang,China]
  • Loại hình kinh doanh:nhà chế tạo
  • Main Mark: Châu Mỹ , Châu Á , Đông Âu , Châu Âu , Bắc Âu , Các thị trường khác , Tây Âu , Trên toàn thế giới
  • xuất khẩu:91% - 100%
  • certs:GS, CE, ISO9001, ISO14000
  • Sự miêu tả:Parathyroid Hormone Fragment 52232-67-4,Thành phần Hormone Độc giáp CAS 52232-67-4,PTH 1-34 Con người
Taizhou Volsen Chemical Co., Ltd. Parathyroid Hormone Fragment 52232-67-4,Thành phần Hormone Độc giáp CAS 52232-67-4,PTH 1-34 Con người
Nhà > Sản phẩm > Sản phẩm peptide > Mỡ Hóc môn Ngoại Tuyến Parathyroid (1-34) (CAS 52232-67-4)

Mỡ Hóc môn Ngoại Tuyến Parathyroid (1-34) (CAS 52232-67-4)

Chia sẻ với:  
    Đơn giá: USD 1 / Kilogram
    Hình thức thanh toán: T/T
    Incoterm: CIF
    Đặt hàng tối thiểu: 1 Kilogram
    Thời gian giao hàng: 15 Ngày

Thông tin cơ bản

Mẫu số: 52232-67-4

Additional Info

Bao bì: THEO YÊU CẦU

Năng suất: KGS

Thương hiệu: VOLSENCHEM

Giao thông vận tải: Air

Xuất xứ: TRUNG QUỐC

Cung cấp khả năng: TRUE MANUFACTURER

Giấy chứng nhận: GMP Peptide

Mô tả sản phẩm


Chúng tôi là một trong những Teriparatide Acetate

CAS 52232-67-4 nhà cung cấp ở thị trường Trung Quốc. Teriparatide là một dạng tái tổ hợp của hoóc môn tuyến cận giáp. Nó là chất anabolic hiệu quả (tức là tăng trưởng xương) được sử dụng trong điều trị một số dạng loãng xương và đôi khi cũng được sử dụng ngoài nhãn để tăng tốc độ nứt gãy. Teriparatide Acetate 52232-67-4 được biết đến với hoạt động nhanh, chất lượng ổn định và độ tinh khiết cao. Chúng tôi đánh giá cao bởi rất nhiều khách hàng mà chúng tôi đã hợp tác.



Thera. Cát egory: Dược Peptide

Cas Số:. 52232-67-4

Từ đồng nghĩa: parathyroid hormone NHÂN: Fragment 1-34; Parathyroid hormone (NHÂN, 1-34); Parathyroid hormone (1-34), NHÂN; PTH (1-34) (NHÂN); PTH (NHÂN, 1-34); Teriparatide; Teriparatide acetate; SVSEIQLMHNLGKHLNSMVEVELRKKLQDVHNF

52232-67-4

Công thức phân tử: C172H278N52O47S2

Trọng lượng phân tử: 3890,49792

Thanh Tịnh: ≥98%

Đóng gói: xuất khẩu bao bì xứng đáng

Bảng Dữ liệu An toàn Vật liệu: Có sẵn theo yêu cầu

Cách sử dụng: trong điều trị một số dạng loãng xương

Danh mục sản phẩm : Sản phẩm peptide

Hình ảnh sản phẩm
  • Mỡ Hóc môn Ngoại Tuyến Parathyroid (1-34) (CAS 52232-67-4)
Gửi email cho nhà cung cấp này
  • *Chủ đề:
  • *Tin nhắn:
    Tin nhắn của bạn phải trong khoảng từ 20-8000 nhân vật

Trang web di động Chỉ số. Sơ đồ trang web


Đăng ký vào bản tin của chúng tôi:
Nhận được Cập Nhật, giảm giá, đặc biệt
Cung cấp và giải thưởng lớn!

MultiLanguage:
Bản quyền © 2019 Taizhou Volsen Chemical Co., Ltd. tất cả các quyền.
Giao tiếp với nhà cung cấp?Nhà cung cấp
Amy Cheng Ms. Amy Cheng
Tôi có thể giúp gì cho bạn?
Trò chuyện bây giờ Liên hệ với nhà cung cấp