Thông tin công ty
  • Taizhou Volsen Chemical Co., Ltd.

  •  [Zhejiang,China]
  • Loại hình kinh doanh:nhà chế tạo
  • Main Mark: Châu Mỹ , Châu Á , Đông Âu , Châu Âu , Bắc Âu , Các thị trường khác , Tây Âu , Trên toàn thế giới
  • xuất khẩu:91% - 100%
  • certs:GS, CE, ISO9001, ISO14000
  • Sự miêu tả:Teriparatide Acetate PTH 1-34,Peptide Fragment Teriparatide Acetate 52232-67-4,Chất lượng tốt Polypeptide Hormones Powder Teriparat 52232-67-4
Taizhou Volsen Chemical Co., Ltd. Teriparatide Acetate PTH 1-34,Peptide Fragment Teriparatide Acetate 52232-67-4,Chất lượng tốt Polypeptide Hormones Powder Teriparat 52232-67-4
Nhà > Sản phẩm > Sản phẩm peptide > ĐIỀU TRỤC PARATHYROID (CON NGƯỜI, 1-34) 52232-67-4

ĐIỀU TRỤC PARATHYROID (CON NGƯỜI, 1-34) 52232-67-4

Chia sẻ với:  
    Đơn giá: USD 1 / Kilogram
    Hình thức thanh toán: T/T
    Incoterm: CIF
    Đặt hàng tối thiểu: 1 Kilogram
    Thời gian giao hàng: 15 Ngày

Thông tin cơ bản

Mẫu số: 52232-67-4

Additional Info

Bao bì: THEO YÊU CẦU

Năng suất: KGS

Thương hiệu: VOLSENCHEM

Giao thông vận tải: Air

Xuất xứ: TRUNG QUỐC

Cung cấp khả năng: TRUE MANUFACTURER

Giấy chứng nhận: GMP Peptide

Mô tả sản phẩm

Chúng tôi, Trung Quốc Teriparatide Acetate 52232-67-4 Nhà cung cấp và Trung Quốc pTH (1-34) ( Con người) | Teriparatide Các nhà sản xuất cung cấp Trung Quốc Đoạn hoocmon tuyến cận giáp (1-34) sản phẩm Và các sản phẩm có liên quan với China PARATHYROID HORMONE HUMAN 1-34

Thera. Cát egory: Pharmaceutical Peptide

.: 52232-67-4 < / Span>

Từ đồng nghĩa < / Span> PARATHYROID HORMONE CON NGƯỜI: PHẠM VI 1-34 ; PARATHYROID HORMONE (NGƯỜI, 1-34) ; PARATHYROID HORMONE (1-34), CON NGƯỜI ; PTH (1-34) (HUMAN) ; PTH (NGƯỜI, 1-34) ; TERIPARATIDE ; Teriparatide Acetate ; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

chất lượng tốt Polypeptide Hormones Powder Teriparatide

C172H278N52O47S2 < / Span>
/ P>

Trọng lượng phân tử : < Span style = "font-family: Tahoma; line-height: normal; màu nền: #FAFAFA;"; > 3890.49792 Độ tinh khiết:

/ Span>

Đóng gói : Xuất khẩu xứng đáng gói Dữ liệu An toàn Dữ liệu : Có sẵn theo yêu cầu P> Cách sử dụng: Teriparatide giống hệt với một phần của hoóc môn cận giáp của con người (PTH) và sử dụng liên tục kích hoạt osteoblasts nhiều hơn osteoclates dẫn đến Tăng tổng thể xương.

Danh mục sản phẩm : Sản phẩm peptide

Hình ảnh sản phẩm
  • ĐIỀU TRỤC PARATHYROID (CON NGƯỜI, 1-34) 52232-67-4
Gửi email cho nhà cung cấp này
  • *Chủ đề:
  • *Tin nhắn:
    Tin nhắn của bạn phải trong khoảng từ 20-8000 nhân vật
Bản quyền © 2019 Taizhou Volsen Chemical Co., Ltd. tất cả các quyền.
Giao tiếp với nhà cung cấp?Nhà cung cấp
Amy Cheng Ms. Amy Cheng
Tôi có thể giúp gì cho bạn?