Thông tin công ty
  • Taizhou Volsen Chemical Co., Ltd.

  •  [Zhejiang,China]
  • Loại hình kinh doanh:nhà chế tạo
  • Main Mark: Châu Mỹ , Châu Á , Đông Âu , Châu Âu , Bắc Âu , Các thị trường khác , Tây Âu , Trên toàn thế giới
  • xuất khẩu:91% - 100%
  • certs:GS, CE, ISO9001, ISO14000
  • Sự miêu tả:Teriparatide Acetate,52232-67-4,CAS 52232-67-4
Taizhou Volsen Chemical Co., Ltd. Teriparatide Acetate,52232-67-4,CAS 52232-67-4
Nhà > Sản phẩm > Sản phẩm peptide > Teriparatide Acetate 52232-67-4

Teriparatide Acetate 52232-67-4

Chia sẻ với:  
    Đơn giá: 1~1 USD
    Hình thức thanh toán: T/T
    Incoterm: CIF
    Đặt hàng tối thiểu: 1 Kilogram
    Thời gian giao hàng: 15 Ngày

Thông tin cơ bản

Mẫu số: 52232-67-4

Additional Info

Bao bì: THEO YÊU CẦU

Năng suất: KGS

Thương hiệu: VOLSENCHEM

Giao thông vận tải: Air

Xuất xứ: TRUNG QUỐC

Cung cấp khả năng: TRUE MANUFACTURER

Giấy chứng nhận: GMP Peptide

Mô tả sản phẩm

Chúng tôi, Trung Quốc Teriparatide Acetate 52232-67-4 Nhà cung cấp và Trung Quốc PTH (1-34) (con người) | Teriparatide Các nhà sản xuất, cung cấp đoạn hoóc môn tuyến cận giáp Trung Quốc (1-34) sản phẩm và các sản phẩm liên quan với Trung Quốc parathyroid hormone NHÂN 1-34

Thera. Cát egory: Dược Peptide

Cas Số:. 52232-67-4

Từ đồng nghĩa: parathyroid hormone NHÂN: Fragment 1-34; Parathyroid hormone (NHÂN, 1-34); Parathyroid hormone (1-34), NHÂN; PTH (1-34) (NHÂN); PTH (NHÂN, 1-34); Teriparatide; Teriparatide acetate; SVSEIQLMHNLGKHLNSMVEVELRKKLQDVHNF

52232-67-4

Công thức phân tử: C172H278N52O47S2

Trọng lượng phân tử: 3890,49792

Thanh Tịnh: ≥98%

Đóng gói: xuất khẩu bao bì xứng đáng

Bảng Dữ liệu An toàn Vật liệu: Có sẵn theo yêu cầu

Cách sử dụng: Teriparatide là giống với một phần của hormone con người parathyrod (PTH) và sử dụng liên tục kích hoạt các nguyên bào xương hơn osteoclates, dẫn đến sự gia tăng tổng thể trong xương.

Danh mục sản phẩm : Sản phẩm peptide

Hình ảnh sản phẩm
  • Teriparatide Acetate 52232-67-4
Gửi email cho nhà cung cấp này
  • *Chủ đề:
  • *Tin nhắn:
    Tin nhắn của bạn phải trong khoảng từ 20-8000 nhân vật

Trang web di động Chỉ số. Sơ đồ trang web


Đăng ký vào bản tin của chúng tôi:
Nhận được Cập Nhật, giảm giá, đặc biệt
Cung cấp và giải thưởng lớn!

MultiLanguage:
Bản quyền © 2019 Taizhou Volsen Chemical Co., Ltd. tất cả các quyền.
Giao tiếp với nhà cung cấp?Nhà cung cấp
Amy Cheng Ms. Amy Cheng
Tôi có thể giúp gì cho bạn?
Trò chuyện bây giờ Liên hệ với nhà cung cấp