Giao tiếp với nhà cung cấp? Nhà cung cấp
Amy Cheng Ms. Amy Cheng
Tôi có thể giúp gì cho bạn?
Trò chuyện bây giờ Liên hệ với nhà cung cấp
Taizhou Volsen Chemical Co., Ltd.
Trang ChủSản phẩmSản phẩm peptideTeriparatide Acetate 52232-67-4
Teriparatide Acetate 52232-67-4
  • Teriparatide Acetate 52232-67-4

Teriparatide Acetate 52232-67-4

    Đơn giá: 1~1 USD
    Hình thức thanh toán: T/T
    Incoterm: CIF
    Đặt hàng tối thiểu: 1 Kilogram
    Thời gian giao hàng: 15 Ngày

Thông tin cơ bản

Mẫu số: 52232-67-4

Additional Info

Bao bì: THEO YÊU CẦU

Năng suất: KGS

Thương hiệu: VOLSENCHEM

Giao thông vận tải: Air

Xuất xứ: TRUNG QUỐC

Cung cấp khả năng: TRUE MANUFACTURER

Giấy chứng nhận: GMP Peptide

Mô tả sản phẩm

Chúng tôi, Trung Quốc Teriparatide Acetate 52232-67-4 Nhà cung cấp và Trung Quốc PTH (1-34) (con người) | Teriparatide Các nhà sản xuất, cung cấp đoạn hoóc môn tuyến cận giáp Trung Quốc (1-34) sản phẩm và các sản phẩm liên quan với Trung Quốc parathyroid hormone NHÂN 1-34

Thera. Cát egory: Dược Peptide

Cas Số:. 52232-67-4

Từ đồng nghĩa: parathyroid hormone NHÂN: Fragment 1-34; Parathyroid hormone (NHÂN, 1-34); Parathyroid hormone (1-34), NHÂN; PTH (1-34) (NHÂN); PTH (NHÂN, 1-34); Teriparatide; Teriparatide acetate; SVSEIQLMHNLGKHLNSMVEVELRKKLQDVHNF

52232-67-4

Công thức phân tử: C172H278N52O47S2

Trọng lượng phân tử: 3890,49792

Thanh Tịnh: ≥98%

Đóng gói: xuất khẩu bao bì xứng đáng

Bảng Dữ liệu An toàn Vật liệu: Có sẵn theo yêu cầu

Cách sử dụng: Teriparatide là giống với một phần của hormone con người parathyrod (PTH) và sử dụng liên tục kích hoạt các nguyên bào xương hơn osteoclates, dẫn đến sự gia tăng tổng thể trong xương.

Danh mục sản phẩm : Sản phẩm peptide

Gửi email cho nhà cung cấp này
  • Amy ChengMs. Amy Cheng
  • Tin nhắn của bạn phải trong khoảng từ 20-8000 nhân vật

Danh sách sản phẩm liên quan

Nhà

Phone

Về chúng tôi

Yêu cầu thông tin